DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Wwc2

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001102581.1 Gene:Wwc2 / 498630 RGDID:1559427 Length:1194 Species:Rattus norvegicus


Alignment Length:223 Identity:40/223 - (17%)
Similarity:54/223 - (24%) Gaps:126/223 - (56%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 AGEPPLPPAWEARMDSHGRIFYIDHTTRTTSWQRPGAAPSGGPAGREQHHRQQLDRRYQSIRRTI 697
            :|:.|||..||...|..|::|||||.||.|||..|               |.:|.:         
  Rat     7 SGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDP---------------RDRLTK--------- 47

  Fly   698 TNESRAAQLYNLPTSANSNANSTAPAAPPPATAIHPAILMLCRPDFYSLLHTNEAALAIYNRNAA 762
                                               |.....|..|                    
  Rat    48 -----------------------------------PLSFADCVGD-------------------- 57

  Fly   763 LKHMVMRIRRDPPCFQRYQYNKDLVALVNTFAQMSRELPSCWETKLDQSGKQFFIDHQHRRTSFM 827
                                                |||..||...|.....::|||.::.|...
  Rat    58 ------------------------------------ELPWGWEAGFDPQIGAYYIDHINKTTQIE 86

  Fly   828 DPRLPVECPRVVRHRQQHSQQQSSVGYY 855
            |||           :|...:|:..:..|
  Rat    87 DPR-----------KQWRGEQEKMLKDY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809 16/28 (57%)
HECTc 1068..1424 CDD:238033
HECTc 1092..1423 CDD:214523
Wwc2NP_001102581.1 WW 12..41 CDD:278809 16/28 (57%)
WW 59..88 CDD:278809 9/28 (32%)
DUF342 <283..385 CDD:302792
YlqD 351..>420 CDD:287979
C2_Kibra 699..822 CDD:176062
Phage_Nu1 <1095..>1153 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.