DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and bag3

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001003533.1 Gene:bag3 / 445139 ZFINID:ZDB-GENE-040801-40 Length:459 Species:Danio rerio


Alignment Length:319 Identity:76/319 - (23%)
Similarity:116/319 - (36%) Gaps:103/319 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   800 LPSCWETKLD-QSGKQFFIDHQHRRTSFMDPR--------------------------------- 830
            ||..||.|:| |:|..||:||.:|.|::.|||                                 
Zfish     7 LPPGWEIKIDPQTGWPFFVDHNNRTTTWNDPRHDTKKIFSNGPSMSPETPQDMHKTFINEMRQPM 71

  Fly   831 -----LPVECPRVVRHRQQHSQQQSSVGYYYPDLVDGNCLSATSGHINASPASSVSGVPPLPPPR 890
                 :|:  |....:.:...||..|..|.:| .|..|.  .|.|. ..||..:....|..|...
Zfish    72 LRQGYIPI--PVCHENPEPRLQQYPSFSYIHP-AVQQNL--RTDGR-TPSPTPAAHCRPRSPVQT 130

  Fly   891 PSSS-SSSSRSSHG-HGHNCNTTSAISCALNAD--------RSAY--------GAAGMASAGATA 937
            ||.: ||.|.:||| .|:....|......|:..        |:.|        ||.|:..:..:.
Zfish   131 PSEACSSCSPTSHGPEGYQPQGTHQQISGLHQQPRSSNTGLRAGYIPIPVIHEGAGGVLPSQLSQ 195

  Fly   938 AGY--------EDVPIAYNE-------KVIAFLRQPNILEILRERQGQHTMSRQLREKINILRVE 987
            :.:        |.|||...:       :|....:.|.:.:|:.||.       |:::.|      
Zfish   196 SSHPTREKIYREQVPIQIQQNRAASPIQVPLRAQSPVMAQIMGERP-------QMQQHI------ 247

  Fly   988 GVPAL-ERLGHDLQLTILLSLFEQEIMGFVPIEERS--PQ---GSPVLNSRMPQRAPPP 1040
            |..|: .::.|.::..|.:..||      |||:..|  ||   ..||...:.|.:.|.|
Zfish   248 GHTAIPSKIEHPVEEIIRVPTFE------VPIQRVSEVPQQIHHQPVQQQQQPTQQPQP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033
HECTc 1092..1423 CDD:214523
bag3NP_001003533.1 WW 6..38 CDD:197736 15/30 (50%)
BAG 358..432 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.