DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hecw and CG3356

DIOPT Version :10

Sequence 1:NP_572574.2 Gene:Hecw / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_611896.1 Gene:CG3356 / 37876 FlyBaseID:FBgn0034989 Length:1122 Species:Drosophila melanogaster


Alignment Length:52 Identity:11/52 - (21%)
Similarity:25/52 - (48%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EDFIEASWIGIGLLSVVSIASLLFIVLIAYFTLAELTKRAGIMSESTKRQQN 129
            |.:|:.:.||:  |..:::..::..|::..|:.|...:...|.:....|..|
  Fly   105 EKYIDPAMIGV--LVAMAVMFIIICVVLRLFSKARWRENRTIFNTPNPRLMN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HecwNP_572574.2 PHA03247 <411..562 CDD:223021
WW 638..667 CDD:459800
HECW1_helix 738..794 CDD:465766
HECTc 1068..1424 CDD:238033
CG3356NP_611896.1 HECTc 766..1120 CDD:238033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.