DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Hace1

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:XP_006256657.1 Gene:Hace1 / 361866 RGDID:1306114 Length:916 Species:Rattus norvegicus


Alignment Length:407 Identity:163/407 - (40%)
Similarity:244/407 - (59%) Gaps:32/407 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1027 PVLNSRMPQ--RAPPPFRRDFEAKLRSFYRKLESKGYGQGPHKLKLH----------IRRSHLLE 1079
            |.|.||...  :|.|     |:.:...||..|.|   || |....:|          :.|..:..
  Rat   516 PELMSRFMHIIKAQP-----FKDRCEWFYEHLHS---GQ-PDSDMVHRPVSENDILLVHRDSIFR 571

  Fly  1080 DAFRRIMSANKKDLQRGRLAVLWDTEEGLDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQ 1144
            .:...:..||...|::| :||.:..|||:.. |..||:|.:||.|:.||.|.||..||:.| |.|
  Rat   572 SSCEIVSKANCAKLKQG-IAVRFHGEEGMGQ-GVVREWFDILSNEIVNPDYALFTQSADGT-TFQ 633

  Fly  1145 VSPLSAFVDNCH-DWFRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVALSDLESLDNEFHQS 1208
            .:. :::|:..| ::|||:|::|||||.|:.|::.:|||.|||.:|.:||...|:.|:|.|:.::
  Rat   634 PNS-NSYVNPDHLNYFRFAGQILGLALNHRQLVNIYFTRSFYKHILGIPVNYQDVASIDPEYAKN 697

  Fly  1209 LQWIRDNDIGTGVDLG--LTFCVTEELLGSVVDRELKPGGKNIIINEKNKKEYLERMIKWRLERG 1271
            ||||.||||.   |||  |||.|..::.|::.:..|||||.:|::.:.||.||::.:.:.|:.|.
  Rat   698 LQWILDNDIS---DLGLELTFSVETDVFGAMEEVPLKPGGGSILVTQNNKAEYVQLVTELRMTRA 759

  Fly  1272 VQEQTESLVRGFYEVIDSRLVSVFDARELELVIAGTAEIDTNDWRLNTEYRSGYHDNHQVIVWFW 1336
            :|.|..:.::||:..|...|:.:||..||||:::|..|||.|||..||||.|||.....||.|||
  Rat   760 IQPQINAFLQGFHMFIPPSLIQLFDEYELELLLSGMPEIDVNDWIKNTEYTSGYEREDPVIQWFW 824

  Fly  1337 QVIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRRFCIEKWG-KPNALPRAHTCFNRLDL 1400
            :|:|..:.|:|:.|||||||:|.:|:.||:.:.|.:|.:.|.|.... .||.||.:.||.|.|.|
  Rat   825 EVVEDMTQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKL 889

  Fly  1401 PPYPTPELLYEKLLLAV 1417
            |.||:.|:|.::||:|:
  Rat   890 PEYPSKEILKDRLLVAL 906

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 149/364 (41%)
HECTc 1092..1423 CDD:214523 145/330 (44%)
Hace1XP_006256657.1 ANK repeat 66..95 CDD:293786
ANK 66..93 CDD:197603
Ank_2 69..194 CDD:289560
ANK 92..217 CDD:238125
ANK repeat 97..128 CDD:293786
ANK repeat 130..161 CDD:293786
Ank_2 135..222 CDD:289560
ANK repeat 163..194 CDD:293786
ANK repeat 196..221 CDD:293786
Ank_4 199..249 CDD:290365
HECTc 561..910 CDD:238033 148/353 (42%)
HECTc 586..909 CDD:214523 144/328 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000080
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.