DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Bag3

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_038891.4 Gene:Bag3 / 29810 MGIID:1352493 Length:577 Species:Mus musculus


Alignment Length:608 Identity:126/608 - (20%)
Similarity:207/608 - (34%) Gaps:205/608 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 AAAAGAALMEPGTGTVSGSSGAGAAGEPPLPPAWEARMDSH-GRIFYIDHTTRTTSWQRPGAAPS 672
            :||..:.:|:.       :||.||:...||||.||.::|.. |..|::||.:|||:|..|...|.
Mouse     2 SAATQSPMMQM-------ASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPE 59

  Fly   673 G---------GPAG--------REQH---------------------HRQ--------------- 684
            |         ||:.        ||.|                     :||               
Mouse    60 GPKDTASSANGPSRDGSRLLPIREGHPIYPQLRPGYIPIPVLHEGSENRQPHLFHAYSQPGVQRF 124

  Fly   685 ------QLDRRYQS-IRRTITNESRA-AQLYNLPTSANSNANSTAPAAPP----PATAIHPAILM 737
                  ...:|.|| :|..:|..::. .|...:|.:|     :||.|.||    |..:..||   
Mouse   125 RTEAAAATPQRSQSPLRGGMTEAAQTDKQCGQMPATA-----TTAAAQPPTAHGPERSQSPA--- 181

  Fly   738 LCRPDFYSLLHTNEAALAIYNRNAALKHMVMR------------IRRD--PPCF---QRYQYNKD 785
              ..|..|  .::.|:|....|::...|.:.|            |.|.  .|.|   |:..|.  
Mouse   182 --ASDCSS--SSSSASLPSSGRSSLGSHQLPRGYIPIPVIHEQNITRPAAQPSFHQAQKTHYP-- 240

  Fly   786 LVALVNTFAQMSRELP----------SCWETKLDQSGKQF---FIDHQHRRTSFMDPRLPVECPR 837
                    ||.....|          ..||.:..::...|   ......|..|......||.||.
Mouse   241 --------AQQGEYQPQQPVYHKIQGDDWEPRPLRAASPFRSPVRGASSREGSPARSGTPVHCPS 297

  Fly   838 VVR------------HR------QQHSQQQSSVGYYYPDLVDGNC-LSATSGHINASPASSVSGV 883
            .:|            ||      |..::.:|..|...|||..|:. :.......::.|.|..|..
Mouse   298 PIRVHTVVDRPQPMTHREPPPVTQPENKPESKPGPAGPDLPPGHIPIQVIRREADSKPVSQKSPP 362

  Fly   884 P-----------PLPPPRPSSSSSSSRSSHGHGHNCNTTSAISCALNADRSAYGAAGMASAGATA 937
            |           |:|.|.||.:.|:..|...:             :.|::.|..:...|...|..
Mouse   363 PAEKVEVKVSSAPIPCPSPSPAPSAVPSPPKN-------------VAAEQKAAPSPAPAEPAAPK 414

  Fly   938 AGYEDVPIAYNEKVIAFLRQPNILEILRERQGQHTMSRQLREKINILRVEGVPALERLGHDLQLT 1002
            :|..:.|          .:.|.:|::           ..:.||:..|. :.|.:.|....|.:..
Mouse   415 SGEAETP----------PKHPGVLKV-----------EAILEKVQGLE-QAVDSFEGKKTDKKYL 457

  Fly  1003 ILLSLFEQEIMGFVPIEERSPQGSPVLNSRMPQRAPPPFRRDFEAKLRSFYRKLESKGYGQGPHK 1067
            ::.....:|::.   ::...|:|...:...         |||...|:::...|||.|.. ..|.:
Mouse   458 MIEEYLTKELLA---LDSVDPEGRADVRQA---------RRDGVRKVQTILEKLEQKAI-DVPGQ 509

  Fly  1068 LKLH-IRRSHL-LEDAFRRIMSA 1088
            :::: ::.|:| .|...:.||.|
Mouse   510 VQVYELQPSNLEAEQPLQEIMGA 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809 14/29 (48%)
HECTc 1068..1424 CDD:238033 6/23 (26%)
HECTc 1092..1423 CDD:214523
Bag3NP_038891.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 27/85 (32%)
WW 23..55 CDD:197736 15/31 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..207 22/92 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..427 44/230 (19%)
BAG 426..503 CDD:214591 17/100 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..577 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.