DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Wwtr1

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001020040.1 Gene:Wwtr1 / 295062 RGDID:1559609 Length:395 Species:Rattus norvegicus


Alignment Length:375 Identity:73/375 - (19%)
Similarity:117/375 - (31%) Gaps:145/375 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 DGGQEQGQEQSDEVVHISSTRLPSIPERSAAAAAAAAAAAAGAALMEPGTGTVSGSSGAGAAGEP 636
            |.|....|..:|........||        |..|....:.:..|.::.||       ||||||.|
  Rat    57 DSGSHSRQSSTDSSGGHPGPRL--------AGGAQHVRSHSSPASLQLGT-------GAGAAGGP 106

  Fly   637 ------------------PLPPAWEARMDSHGRIFYIDHTTRTTSWQRPGAAPSGGPAGREQHHR 683
                              ||||.||....:.|:.::::|..:.|:||.|               |
  Rat   107 AQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDP---------------R 156

  Fly   684 QQLDR--RYQSIRRTITN-----ESRAAQLYNLPTS-------ANSNANSTAPAAPPPATAIHPA 734
            :.:::  .:.::..|||:     .|.|....||..:       |.|.:....||..||.      
  Rat   157 KVMNQPLNHVNLHPTITSTSVPQRSMAVSQPNLAMNHQHQQVVATSLSPQNHPAQNPPT------ 215

  Fly   735 ILMLCRPDFYSLLHTNEAALAIYNRNAALKHMVMRIRRDPPCFQRYQYNKDLV-----ALVNTFA 794
                             ..:::.|.....:....::|     .||.|..::.:     .|:...|
  Rat   216 -----------------GLMSVPNALTTQQQQQQKLR-----LQRIQMERERIRMRQEELMRQEA 258

  Fly   795 QMSRELPSCWETKLDQSGKQFFIDHQHRRTSFMDPRLPVECPRVVRHRQQHSQQQSS-----VGY 854
            .:.|:||...||....:......|.:....|..||.|        .....||::||:     :|.
  Rat   259 ALCRQLPMETETMAPVNTPAMNTDMRSVTNSSSDPFL--------NGGPYHSREQSTDSGLGLGC 315

  Fly   855 Y-----------------------------------YPDLVDGNCLSATS 869
            |                                   :||.:|  ||..|:
  Rat   316 YSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQTRFPDFLD--CLPGTN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809 10/28 (36%)
HECTc 1068..1424 CDD:238033
HECTc 1092..1423 CDD:214523
Wwtr1NP_001020040.1 WW 125..156 CDD:197736 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.