DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and HERC4

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:367 Identity:112/367 - (30%)
Similarity:184/367 - (50%) Gaps:28/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1068 LKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAVLWDTEEGLDYGGPSREFFFLLSRELFNPYYGL 1132
            |.|.:||.:::.||...:......|.:: .|.|::..|:.:|.||..:|||.|:.|||.:|.||:
Human   733 LILVVRRENIVGDAMEVLRKTKNIDYKK-PLKVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGM 796

  Fly  1133 FEYSANDTYTVQVSPLSAFVDNCHDWFRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVALSD 1197
            |.| ..|:..:..|. ..|.|:  |.|...|.:.|||:.:..::|..|....||.||:...:|.|
Human   797 FRY-YEDSRLIWFSD-KTFEDS--DLFHLIGVICGLAIYNCTIVDLHFPLALYKKLLKKKPSLDD 857

  Fly  1198 LESLDNEFHQSLQWIRD--NDIGTGVDLGLTFC----VTEELLGSVVDRELKPGGKNIIINEKNK 1256
            |:.|..:..:|:|.:.|  .|     |:..|||    :|.|..|:...:||...|.:..:|::|:
Human   858 LKELMPDVGRSMQQLLDYPED-----DIEETFCLNFTITVENFGATEVKELVLNGADTAVNKQNR 917

  Fly  1257 KEYLERMIKWRLERGVQEQTESLVRGFYEVIDSRLVSVFDARELELVIAGTAEIDTNDWRLNTEY 1321
            :|:::..:.:...:.|....::...||::|...:::.:|...||:.::.|....|..:...||||
Human   918 QEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEY 982

  Fly  1322 RSGYHDNHQVIVWFWQVIERFSNEQRLRLLQFVTGTSSIPYEGFSALR---GSTGPRRFCIEKWG 1383
            :..|...|..|..||:|......|::.:.|.|:||:..||..|..:|:   .|||         |
Human   983 KGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTG---------G 1038

  Fly  1384 KPNALPRAHTCFNRLDLPPYPTPELLYEKLLLAVEETNTFGI 1425
            ....||.:|||||.||||.|...|.|..||:.|::....|.:
Human  1039 GEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 111/364 (30%)
HECTc 1092..1423 CDD:214523 105/339 (31%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 111/364 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.