DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Hectd2

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:NP_001156943.1 Gene:Hectd2 / 226098 MGIID:2442663 Length:775 Species:Mus musculus


Alignment Length:417 Identity:124/417 - (29%)
Similarity:203/417 - (48%) Gaps:57/417 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1042 RRDFEAKLRSFYRK--LESKGYGQGPHK----LKLHIRRSHLLEDAFRRIMSANKKDLQRGRLAV 1100
            :||.|.::.|..|:  ::.....|.|..    |.:.:||:||:.|:... ::..:.||:: :|.|
Mouse   384 QRDSEQQMISIARQSLVDKVSRRQRPDMNMLFLNMKVRRTHLVSDSLDE-LTRKRADLKK-KLKV 446

  Fly  1101 LWDTEEGLDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQVSPLSAFVDNCHDW------- 1158
            .:..|.|||.||.::|:|.||.|::|:|.||:|.|..:              .:|| |       
Mouse   447 TFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMFTYHKD--------------SHCH-WFSSFKCD 496

  Fly  1159 ----FRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVALSDLE--------SLDN------EF 1205
                ||..|.::|||:.:...||..|....||.||..||..||..        ::|:      |.
Mouse   497 NYSEFRLVGILMGLAVYNSITLDIRFPPCCYKKLLSPPVVPSDQSTPVGICSVTIDDLCQVMPEL 561

  Fly  1206 HQSLQWIRDNDIGTGVDLGLTFCVTEELLGSVVDRELKPGGKNIIINEKNKKEYLERMIKWRLER 1270
            ...|:.:...:.....|...||.|.:|..|.:....|||||..|.:..:|::||::....:.|.:
Mouse   562 AHGLKELLSYEGNVEEDFYSTFQVFQEEFGVIKSYNLKPGGDKIPVTNQNRREYVQLYTDFLLNK 626

  Fly  1271 GVQEQTESLVRGFYEVIDSRLVSVFDARELELVIAGTAEIDTNDWRLNTEYRSGYHDNHQVIVWF 1335
            .:.:|..:...||:.|..|..:.:....|:|:::.|:.|:|.:..:.:|:| .||......|.:|
Mouse   627 SIYKQFAAFYCGFHSVCASNALMLLRPEEVEILVCGSPELDMHALQRSTQY-DGYAKTDLTIRYF 690

  Fly  1336 WQVIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRRFCIEK-WGKPNALPRAHTCFNRLD 1399
            |.|:..|..|.:.:||.|.||:..:|..|.:.|       .|.|.| ....|.||.||||||:|.
Mouse   691 WDVVLGFPLELQKKLLHFTTGSDRVPVGGMADL-------NFKISKNETSTNWLPVAHTCFNQLC 748

  Fly  1400 LPPYPTPELLYEKLLLAVEETNTFGIE 1426
            ||||.:.:.|.:||::.:..:..||:|
Mouse   749 LPPYKSKKDLKQKLIIGISNSEGFGLE 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809
HECTc 1068..1424 CDD:238033 114/381 (30%)
HECTc 1092..1423 CDD:214523 108/356 (30%)
Hectd2NP_001156943.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
HECTc 416..773 CDD:238033 114/381 (30%)
HECTc 439..772 CDD:214523 108/356 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.