DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42797 and Yap1

DIOPT Version :9

Sequence 1:NP_572574.2 Gene:CG42797 / 31905 FlyBaseID:FBgn0261931 Length:1426 Species:Drosophila melanogaster
Sequence 2:XP_006509915.1 Gene:Yap1 / 22601 MGIID:103262 Length:494 Species:Mus musculus


Alignment Length:426 Identity:88/426 - (20%)
Similarity:132/426 - (30%) Gaps:194/426 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 PPTPTHHARRHARLQAVTANSSLASGGAIPSDPPAVSSQLDYIYLQDGGQEQGQE------QSDE 584
            ||.|....         .|..|::..|. |:.|||..:....:::: |..|...|      .:.:
Mouse     8 PPQPAPQG---------PAPPSVSPAGT-PAAPPAPPAGHQVVHVR-GDSETDLEALFNAVMNPK 61

  Fly   585 VVHISST---RLPSIPE--------RSAAAAAAAAAAAAGA-----------------ALMEPGT 621
            ..::..|   ||..:|:        :|.:..|:..|..|||                 ..:.|||
Mouse    62 TANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGT 126

  Fly   622 ----GTVSGSSGAGAA-----------GEPPLPPAWEARMDSHGRIFYIDHTTRTTSWQRPGAAP 671
                |.|||.:.|.||           .:.|||..||....|.|:.::::|..:||:||.|    
Mouse   127 LTASGVVSGPAAAPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDP---- 187

  Fly   672 SGGPAGREQHHRQQLDRRYQSIRRTITNESRAAQLYNLPTSANSNANSTAPAAPPPATAIHPAIL 736
                                          |.|.|        |..|..|||:|    |: |..|
Mouse   188 ------------------------------RKAML--------SQLNVPAPASP----AV-PQTL 209

  Fly   737 MLCRPDFYSLLHTNEAALAIYNRNAALKHMVMRIRRDPPCFQRYQYNKDLVALVNTFAQMSRELP 801
            |                      |:|                                  |..||
Mouse   210 M----------------------NSA----------------------------------SGPLP 218

  Fly   802 SCWETKLDQSGKQFFIDHQHRRTSFMDPRLPVECPRVVRHRQQHSQQQSSVGYYYPDLVDGNCLS 866
            ..||..:.|.|:.::|:|:::.||::||||.   ||..:...|...|                  
Mouse   219 DGWEQAMTQDGEVYYINHKNKTTSWLDPRLD---PRFGKAMNQRITQ------------------ 262

  Fly   867 ATSGHINASPASSVSGVPPLPPPRPSSSSSSSRSSH 902
                      ::.|...|||.|..|........||:
Mouse   263 ----------SAPVKQPPPLAPQSPQGGVLGGGSSN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42797NP_572574.2 WW 638..667 CDD:278809 11/28 (39%)
HECTc 1068..1424 CDD:238033
HECTc 1092..1423 CDD:214523
Yap1XP_006509915.1 FAM181 <61..>141 CDD:373671 18/79 (23%)
WW 159..188 CDD:238122 11/62 (18%)
WW 217..246 CDD:366073 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.