DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CDC31

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_014900.3 Gene:CDC31 / 854431 SGDID:S000005783 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:52/144 - (36%)
Similarity:84/144 - (58%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEE 67
            ||..|::..:...:||.|.:|:|.:...||.:.::|||.:..:.|:..:|:|.||:|...:..::
Yeast    16 ELLEEQKQEIYEAFSLFDMNNDGFLDYHELKVAMKALGFELPKREILDLIDEYDSEGRHLMKYDD 80

  Fly    68 FCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQ 132
            |..|:..|:...:..:|::.||::||.::.|.||...||.|...|||.|.|:||..||.|:|||.
Yeast    81 FYIVMGEKILKRDPLDEIKRAFQLFDDDHTGKISIKNLRRVAKELGETLTDEELRAMIEEFDLDG 145

  Fly   133 DNHINFEEFTNMMT 146
            |..||..||..:.|
Yeast   146 DGEINENEFIAICT 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 52/144 (36%)
CDC31NP_014900.3 PTZ00183 14..159 CDD:185503 51/142 (36%)

Return to query results.
Submit another query.