DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CAM4

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001185330.1 Gene:CAM4 / 842959 AraportID:AT1G66410 Length:159 Species:Arabidopsis thaliana


Alignment Length:157 Identity:83/157 - (52%)
Similarity:110/157 - (70%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DELSVEEQDLLKNIYSLLDKDNE----------GAITSKELGMVIRALGRQPNESEVQSMINEVD 56
            |:|:.|:....|..:||.|||.:          |.||:||||.|:|:||:.|.|:|:|.||||||
plant     3 DQLTDEQISEFKEAFSLFDKDGDDSISDSGDSCGCITTKELGTVMRSLGQNPTEAELQDMINEVD 67

  Fly    57 SDGNGSIAKEEFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDEL 121
            :||||:|...||.|::.:||.||:.||||::|||||||:.||:||..|||.|...|||||.|:|:
plant    68 ADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEV 132

  Fly   122 EEMIREYDLDQDNHINFEEFTNMMTTR 148
            ||||||.|:|.|..||:|||..:|..:
plant   133 EEMIREADVDGDGQINYEEFVKIMMAK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 83/155 (54%)
CAM4NP_001185330.1 PTZ00184 1..159 CDD:185504 83/155 (54%)

Return to query results.
Submit another query.