DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and AT1G18530

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_173288.1 Gene:AT1G18530 / 838434 AraportID:AT1G18530 Length:157 Species:Arabidopsis thaliana


Alignment Length:139 Identity:50/139 - (35%)
Similarity:82/139 - (58%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNVILRKM 76
            ||:|:...|.|.:|::|..||..::|:||.:|:..::..::..:||:|||.:..:|....||   
plant     8 LKDIFDRFDMDADGSLTILELAALLRSLGLKPSGDQIHVLLASMDSNGNGFVEFDELVGTIL--- 69

  Fly    77 HDTNKE-----EELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQDNHI 136
            .|.|:|     |:|.:.|:.||::.||:||..||......:|:.|...||.|||:|.|.:.|..|
plant    70 PDLNEEVLINSEQLLEIFKSFDRDGNGFISAAELAGAMAKMGQPLTYKELTEMIKEADTNGDGVI 134

  Fly   137 NFEEFTNMM 145
            :|.||.::|
plant   135 SFGEFASIM 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 50/139 (36%)
AT1G18530NP_173288.1 PTZ00184 2..143 CDD:185504 49/137 (36%)

Return to query results.
Submit another query.