DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CML37

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_199053.1 Gene:CML37 / 834244 AraportID:AT5G42380 Length:185 Species:Arabidopsis thaliana


Alignment Length:147 Identity:46/147 - (31%)
Similarity:77/147 - (52%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68
            |:|.|   |:.::..:|.:::|.|:.:||...:..||...:..||:.::...|.||:|.|..|||
plant    45 LNVNE---LRTVFDYMDANSDGKISGEELQSCVSLLGGALSSREVEEVVKTSDVDGDGFIDFEEF 106

  Fly    69 CNVILRKMH-----DTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREY 128
                |:.|.     |..:.:||::||.::..|...:|:...||.....|||....|..:.|||.:
plant   107 ----LKLMEGEDGSDEERRKELKEAFGMYVMEGEEFITAASLRRTLSRLGESCTVDACKVMIRGF 167

  Fly   129 DLDQDNHINFEEFTNMM 145
            |.:.|..::|:||..||
plant   168 DQNDDGVLSFDEFVLMM 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 46/147 (31%)
CML37NP_199053.1 PTZ00184 47..184 CDD:185504 43/143 (30%)

Return to query results.
Submit another query.