DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CEN2

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001031798.1 Gene:CEN2 / 829855 AraportID:AT4G37010 Length:171 Species:Arabidopsis thaliana


Alignment Length:142 Identity:49/142 - (34%)
Similarity:88/142 - (61%) Gaps:0/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68
            |:.:::..::.|:.|.|.|..|:|.:.||.:.:|:||.:.|..::..::.|||.:.:|:|..:||
plant    24 LTNQKRREIREIFDLFDIDGSGSIDASELNVAMRSLGFEMNNQQINELMAEVDKNQSGAIDFDEF 88

  Fly    69 CNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQD 133
            .:::..|..:.:..:||..||::.|.:|||.||..:::.:...|||...|:::||||.|.|.|:|
plant    89 VHMMTTKFGERDSIDELSKAFKIIDHDNNGKISPRDIKMIAKELGENFTDNDIEEMIEEADRDKD 153

  Fly   134 NHINFEEFTNMM 145
            ..:|.|||..||
plant   154 GEVNLEEFMKMM 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 49/142 (35%)
CEN2NP_001031798.1 PTZ00183 15..169 CDD:185503 49/142 (35%)

Return to query results.
Submit another query.