DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CAM9

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_190760.1 Gene:CAM9 / 824355 AraportID:AT3G51920 Length:151 Species:Arabidopsis thaliana


Alignment Length:144 Identity:50/144 - (34%)
Similarity:86/144 - (59%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKE 66
            |..:.|:.......:.|:|||::|.||.::|..|::::|:.|...::|.|:::||..|||.|..:
plant     3 DAFTDEQIQEFYEAFCLIDKDSDGFITKEKLTKVMKSMGKNPKAEQLQQMMSDVDIFGNGGITFD 67

  Fly    67 EFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLD 131
            :|..::.:.....:..:||.:.|||||::.:|.||..||......:|.|:..:|.|.|:||.|||
plant    68 DFLYIMAQNTSQESASDELIEVFRVFDRDGDGLISQLELGEGMKDMGMKITAEEAEHMVREADLD 132

  Fly   132 QDNHINFEEFTNMM 145
            .|..::|.||:.||
plant   133 GDGFLSFHEFSKMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 50/144 (35%)
CAM9NP_190760.1 PTZ00184 1..148 CDD:185504 50/144 (35%)

Return to query results.
Submit another query.