DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and AT2G36180

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_181160.1 Gene:AT2G36180 / 818190 AraportID:AT2G36180 Length:144 Species:Arabidopsis thaliana


Alignment Length:139 Identity:44/139 - (31%)
Similarity:71/139 - (51%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNVILRK- 75
            :..|:..:||:.:|.|...|....||....|....|:..|...:|.||:|.|...||.:.::.. 
plant     1 MAEIFESVDKNKDGKILWDEFAEAIRVFSPQITSEEIDKMFIVLDVDGDGQIDDVEFASCLMVNG 65

  Fly    76 --MHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQDNHINF 138
              ..||.:|..:::||.::|.:.:|.||.:|:..|...||||...::...|::..|.|.|..:||
plant    66 GGEKDTEEEVVMKEAFDLYDMDGDGKISASEIHVVLKRLGEKHTMEDCVVMVQTVDKDSDGFVNF 130

  Fly   139 EEFTNMMTT 147
            |||..||.:
plant   131 EEFKIMMNS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 44/139 (32%)
AT2G36180NP_181160.1 PTZ00184 3..140 CDD:185504 44/137 (32%)

Return to query results.
Submit another query.