DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and Calml4

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001121047.1 Gene:Calml4 / 691455 RGDID:1583918 Length:153 Species:Rattus norvegicus


Alignment Length:143 Identity:44/143 - (30%)
Similarity:75/143 - (52%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68
            ||.|:.:..|..:||.||...|.|.:.:|.:.:|.||..|...|||..:.....|.||.:....|
  Rat     5 LSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTF 69

  Fly    69 CNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQD 133
            ..::..::...:.::|:..|..:.|||..|||..:|||:..|.|||||...|::|:.:|..::.:
  Rat    70 LTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKEAGIEPN 134

  Fly   134 NHINFEEFTNMMT 146
            ..:.::.|...:|
  Rat   135 GQVKYDTFIQRIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 44/143 (31%)
Calml4NP_001121047.1 PTZ00184 1..144 CDD:185504 43/138 (31%)

Return to query results.
Submit another query.