DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and tnnc2.2

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_571638.1 Gene:tnnc2.2 / 58082 ZFINID:ZDB-GENE-000322-2 Length:160 Species:Danio rerio


Alignment Length:145 Identity:55/145 - (37%)
Similarity:87/145 - (60%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68
            ||.|.....|..:.:.|.|..|.|::||||.|:|.||:.|...|::.:|.|||.||:|||..|||
Zfish    12 LSEEMLAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTREELEEIIEEVDEDGSGSIDFEEF 76

  Fly    69 CNVILRKMHDT---NKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDL 130
            ..:::|.:.:.   ..||||.:.|||.||..:|||...|...:..:.||.:.::|::|::::.|.
Zfish    77 LVMMVRLLKEDQAGKSEEELAECFRVLDKNGDGYIDRDEFAEIIRSTGESISEEEIDELLKDGDK 141

  Fly   131 DQDNHINFEEFTNMM 145
            :.|..::|:||..||
Zfish   142 NNDGMLDFDEFLKMM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 55/145 (38%)
tnnc2.2NP_571638.1 PTZ00184 12..156 CDD:185504 53/143 (37%)

Return to query results.
Submit another query.