DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CABP4

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_660201.1 Gene:CABP4 / 57010 HGNCID:1386 Length:275 Species:Homo sapiens


Alignment Length:149 Identity:57/149 - (38%)
Similarity:82/149 - (55%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEE 67
            ||..||.|.|:..:...|.|.:|.|:.:|||..:|.||..|.|.|:..:...:.....|.:..||
Human   125 ELGPEELDELQAAFEEFDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMRMGGRVDFEE 189

  Fly    68 FCNVILRKMHDTNKE----EELRDAFRVFDKENNGYISTTELR-AVFMALGEKLEDDELEEMIRE 127
            |..:|..|:.:....    .|||.|||.||::.:|.|:..||| ||...|||.|...||:||:||
Human   190 FVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEMLRE 254

  Fly   128 YDLDQDNHINFEEFTNMMT 146
            .||:.|..::|:||..|::
Human   255 VDLNGDGTVDFDEFVMMLS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 57/149 (38%)
CABP4NP_660201.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112
KLF9_13_N-like <56..101 CDD:425361
PTZ00184 125..274 CDD:185504 57/149 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.