DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CABP5

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_062829.1 Gene:CABP5 / 56344 HGNCID:13714 Length:173 Species:Homo sapiens


Alignment Length:148 Identity:47/148 - (31%)
Similarity:84/148 - (56%) Gaps:5/148 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEF 68
            |..:|.:.|:..:...|||.:|.|:.|:||.::|.:|..|.|.|:..:..::..:..|.:..::|
Human    25 LGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDF 89

  Fly    69 CNVILRKMHDTNK----EEELRDAFRVFDKENNGYISTTEL-RAVFMALGEKLEDDELEEMIREY 128
            ..::..|:.....    .:|:||||:.||...:|.|:..|| :|:...|||:|...|:.|::||.
Human    90 VELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREA 154

  Fly   129 DLDQDNHINFEEFTNMMT 146
            |::.|..::||||..||:
Human   155 DVNGDGTVDFEEFVKMMS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 47/148 (32%)
CABP5NP_062829.1 PTZ00184 25..171 CDD:185504 45/145 (31%)

Return to query results.
Submit another query.