DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and calml4

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001011117.1 Gene:calml4 / 496530 XenbaseID:XB-GENE-5936220 Length:153 Species:Xenopus tropicalis


Alignment Length:145 Identity:42/145 - (28%)
Similarity:72/145 - (49%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEV--QSMINEVDSDGNGSIAKE 66
            ||.:.....|..:||.||..:|.|.:.:|..|:|.||..|...||  ...::::..|  |.:...
 Frog     5 LSQDAIQKFKECFSLYDKKGKGKIPAGDLLTVMRCLGTCPTPGEVTRHLQVHKIGKD--GEVDFS 67

  Fly    67 EFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLD 131
            .|..::.|:....:.|.|:..|..:.||:..|.|...||||....:||||..:|::::::...:.
 Frog    68 TFLTIMYRQQKQEDPENEIMVAMLMSDKQKKGVIPLKELRAKLTQMGEKLTPEEVDDLLKGVKVG 132

  Fly   132 QDNHINFEEFTNMMT 146
            .|..:.:|||...:|
 Frog   133 PDGMVKYEEFVRQIT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 42/145 (29%)
calml4NP_001011117.1 PTZ00184 1..144 CDD:185504 41/140 (29%)

Return to query results.
Submit another query.