DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and CG9406

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_611552.1 Gene:CG9406 / 37405 FlyBaseID:FBgn0034592 Length:186 Species:Drosophila melanogaster


Alignment Length:126 Identity:33/126 - (26%)
Similarity:59/126 - (46%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMI---NEVDSDGNGSIAK 65
            |:.|.::.:...:.:.|...:..|.|:.:|.|:|.||..|.|.||:.:|   :.||..|...:.|
  Fly     7 LNNELEEKISEAFCIFDTHGDKYIDSRNVGNVLRFLGCAPTEKEVEDVIKATDSVDYPGEAHLVK 71

  Fly    66 --EEFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEM 124
              |....:::.:..:....|:|.:||...|.||..|::......:....||....:||:.|
  Fly    72 FMEHVSKLLMDRQMEPASSEKLLEAFETLDPENKKYLTKEYFGKLMAEEGEPFSAEELDAM 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 33/126 (26%)
CG9406NP_611552.1 PTZ00184 7..156 CDD:185504 33/126 (26%)

Return to query results.
Submit another query.