DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and TpnC25D

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_608915.2 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster


Alignment Length:142 Identity:43/142 - (30%)
Similarity:87/142 - (61%) Gaps:3/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNV 71
            |:.|:::..:.:.|....|.|.:..|..::.::|:..::||:|::|::.|.:..|.:..:.||::
  Fly     5 EKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCSI 69

  Fly    72 ILRKMHDTNKE---EELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLDQD 133
            ....:.:.:.|   :||::|||::|:|.||||:|:.|:.:..||.:||...:|:.:|.|.|.|..
  Fly    70 AAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDGS 134

  Fly   134 NHINFEEFTNMM 145
            ..::|:||..||
  Fly   135 GTVDFDEFMEMM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 43/142 (30%)
TpnC25DNP_608915.2 PTZ00184 4..146 CDD:185504 41/140 (29%)

Return to query results.
Submit another query.