DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and pvalb5

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_997050.1 Gene:pvalb5 / 335623 ZFINID:ZDB-GENE-050417-336 Length:108 Species:Danio rerio


Alignment Length:63 Identity:19/63 - (30%)
Similarity:35/63 - (55%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KNIYSLLDKDNEGAITSKELGMVIR---ALGRQPNESEVQSMINEVDSDGNGSIAKEEFCNVI 72
            :.::..||:|..|.|..:||...::   :..|:..|:|..:::...|.||:|.|..||||.::
Zfish    45 EKVFKALDQDKSGYIEKEELKRFLQNFCSKARELTEAETNTLLAAGDKDGDGKIGIEEFCALL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 19/63 (30%)
pvalb5NP_997050.1 EFh_parvalbumin_like 10..108 CDD:330177 19/63 (30%)
EF-hand motif 10..38 CDD:319994
EF-hand motif 43..72 CDD:319994 7/26 (27%)
EF-hand motif 82..108 CDD:319994 10/26 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.