DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and cal-2

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_495906.2 Gene:cal-2 / 182789 WormBaseID:WBGene00000286 Length:171 Species:Caenorhabditis elegans


Alignment Length:142 Identity:62/142 - (43%)
Similarity:95/142 - (66%) Gaps:1/142 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKE 66
            |.|:.||....|..:.|.|||..|:|:|||||:.:|:||:.|.|.|:..|:||||.||:|:|...
 Worm    27 DGLNEEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFG 91

  Fly    67 EFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLD 131
            |||. ::::|:..|..|.:|:||||||::.||:|:..|.|.....:|::..|.|::|:|.|.|:|
 Worm    92 EFCQ-MMKRMNKENDSEMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDID 155

  Fly   132 QDNHINFEEFTN 143
            .|..|::|||.:
 Worm   156 GDGQIDYEEFAS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 62/142 (44%)
cal-2NP_495906.2 PTZ00184 27..165 CDD:185504 60/138 (43%)

Return to query results.
Submit another query.