DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31960 and calm2

DIOPT Version :10

Sequence 1:NP_722942.1 Gene:CG31960 / 319047 FlyBaseID:FBgn0051960 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001363414.1 Gene:calm2 / 100496298 XenbaseID:XB-GENE-976642 Length:149 Species:Xenopus tropicalis


Alignment Length:147 Identity:84/147 - (57%)
Similarity:110/147 - (74%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DELSVEEQDLLKNIYSLLDKDNEGAITSKELGMVIRALGRQPNESEVQSMINEVDSDGNGSIAKE 66
            |:|:.|:....|..:||.|||.:|.||:||||.|:|:||:.|.|:|:|.||||||:||||:|...
 Frog     3 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67

  Fly    67 EFCNVILRKMHDTNKEEELRDAFRVFDKENNGYISTTELRAVFMALGEKLEDDELEEMIREYDLD 131
            ||..::.|||.||:.|||:|:|||||||:.|||||..|||.|...|||||.|:|::|||||.|:|
 Frog    68 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADID 132

  Fly   132 QDNHINFEEFTNMMTTR 148
            .|..:|:|||..|||.:
 Frog   133 GDGQVNYEEFVQMMTAK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31960NP_722942.1 PTZ00184 2..148 CDD:185504 84/145 (58%)
calm2NP_001363414.1 PTZ00184 1..149 CDD:185504 84/145 (58%)

Return to query results.
Submit another query.