DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31957 and EIF1AD

DIOPT Version :9

Sequence 1:NP_001260011.1 Gene:CG31957 / 319046 FlyBaseID:FBgn0051957 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001229410.1 Gene:EIF1AD / 84285 HGNCID:28147 Length:165 Species:Homo sapiens


Alignment Length:164 Identity:71/164 - (43%)
Similarity:110/164 - (67%) Gaps:20/164 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRRKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEVETVD-ETFLVSMPNKFRKSMWVKRGDF 72
            ::|||::||:: .::.:|::.|||.||:.:.|||||||||.. :.||||||:|:||::|:|||||
Human     5 TKRKHVVKEVL-GEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDF 68

  Fly    73 LLVEPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKFTKKPVQEEATSQNK------------- 124
            |:|:|||||:||||||..:|..:|::...|...||:.|::  |.|:..::|:             
Human    69 LIVDPIEEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSE--VAEKHNNRNRQTQPELPAEPQLS 131

  Fly   125 -DDSDFED--DLLPNTNRPVNRDSSDEEEDEETS 155
             ::|..||  ||..||||....:|.:|.|:||.:
Human   132 GEESSSEDDSDLFVNTNRRQYHESEEESEEEEAA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31957NP_001260011.1 S1_like 30..106 CDD:299122 45/76 (59%)
EIF1ADNP_001229410.1 Nuclear localization signal. /evidence=ECO:0000255 6..12 3/5 (60%)
S1_eIF1AD_like 25..102 CDD:240218 45/76 (59%)
Nuclear localization signal. /evidence=ECO:0000255 56..65 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..165 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159973
Domainoid 1 1.000 90 1.000 Domainoid score I7822
eggNOG 1 0.900 - - E1_KOG2925
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41860
Inparanoid 1 1.050 136 1.000 Inparanoid score I4578
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55346
OrthoDB 1 1.010 - - D1431625at2759
OrthoFinder 1 1.000 - - FOG0004941
OrthoInspector 1 1.000 - - oto91217
orthoMCL 1 0.900 - - OOG6_104365
Panther 1 1.100 - - LDO PTHR21641
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.