DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31957 and AT2G40780

DIOPT Version :9

Sequence 1:NP_001260011.1 Gene:CG31957 / 319046 FlyBaseID:FBgn0051957 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_181610.1 Gene:AT2G40780 / 818675 AraportID:AT2G40780 Length:171 Species:Arabidopsis thaliana


Alignment Length:172 Identity:59/172 - (34%)
Similarity:92/172 - (53%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEVETVD---ETFLVSMPNKFRKSMWVKRGDF 72
            |::|.:...:.|:.| .|.|.||:|:|.||:|  ::|.:|   |..|...|.|||:|||::||.|
plant     5 RRNLKQAASDQDFTL-EECQSIAQVVSLRGSN--QIEIMDAKGENSLALFPAKFRESMWIRRGSF 66

  Fly    73 LLVEPI------EEGDKVKAEICKILTPEHIKEYTKAAIWPDKF-TKKPVQEEATS---QNKDD- 126
            ::::..      |.|.||.:.:||:|..|.::...|:..||:.| ..:|:..|.:|   |::|| 
plant    67 VVIDHTGKEKAQESGSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTRPIPAEKSSPIEQHEDDG 131

  Fly   127 ----SDFEDDLLP---NTN--RPVNRDSSDEEEDEETSSEED 159
                ||.:|.:.|   |||  ||..     .:.|.||.|..|
plant   132 EVDSSDDDDGMPPLQANTNRLRPFG-----VKCDAETDSGSD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31957NP_001260011.1 S1_like 30..106 CDD:299122 31/84 (37%)
AT2G40780NP_181610.1 eIF1a 18..107 CDD:128900 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 46 1.000 Domainoid score I4613
eggNOG 1 0.900 - - E1_KOG2925
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2406
OMA 1 1.010 - - QHG55346
OrthoDB 1 1.010 - - D1431625at2759
OrthoFinder 1 1.000 - - FOG0004941
OrthoInspector 1 1.000 - - oto4107
orthoMCL 1 0.900 - - OOG6_104365
Panther 1 1.100 - - LDO PTHR21641
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.