DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31957 and Eif1ad

DIOPT Version :9

Sequence 1:NP_001260011.1 Gene:CG31957 / 319046 FlyBaseID:FBgn0051957 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_081512.1 Gene:Eif1ad / 69860 MGIID:1917110 Length:170 Species:Mus musculus


Alignment Length:167 Identity:68/167 - (40%)
Similarity:107/167 - (64%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRRKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEVETVD-ETFLVSMPNKFRKSMWVKRGDF 72
            |:|||:::|:: .::.:|::.|||.:|:.:.|||||||||.. :.||||||:|:||::|:|||||
Mouse     5 SKRKHVVQEVL-GEHMVPSDHQQIVKVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDF 68

  Fly    73 LLVEPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKFTKKPVQEEATSQNKD------------ 125
            |:|:|||||:||||||..:|...|::...|...||:.|::  |.|:..:.|::            
Mouse    69 LIVDPIEEGEKVKAEISFVLCKNHVRSLQKEGHWPEAFSE--VAEKQNNMNRESQPELPAEPQLS 131

  Fly   126 ----DSDFEDDLLPNTNRPVNRDSSDEEEDEETSSEE 158
                .|:.:.||..|||.....:|.:|.|::|...||
Mouse   132 GEGSSSEDDSDLFVNTNHRQYHESEEESEEDEEEEEE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31957NP_001260011.1 S1_like 30..106 CDD:299122 44/76 (58%)
Eif1adNP_081512.1 Nuclear localization signal. /evidence=ECO:0000255 6..12 3/5 (60%)
S1_eIF1AD_like 25..102 CDD:240218 44/76 (58%)
Nuclear localization signal. /evidence=ECO:0000255 56..65 4/8 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..170 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850342
Domainoid 1 1.000 89 1.000 Domainoid score I7880
eggNOG 1 0.900 - - E1_KOG2925
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41860
Inparanoid 1 1.050 133 1.000 Inparanoid score I4591
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004941
OrthoInspector 1 1.000 - - oto94798
orthoMCL 1 0.900 - - OOG6_104365
Panther 1 1.100 - - LDO PTHR21641
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1961
SonicParanoid 1 1.000 - - X4030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.