DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31957 and eif1ad

DIOPT Version :9

Sequence 1:NP_001260011.1 Gene:CG31957 / 319046 FlyBaseID:FBgn0051957 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001016696.1 Gene:eif1ad / 549450 XenbaseID:XB-GENE-5854068 Length:179 Species:Xenopus tropicalis


Alignment Length:173 Identity:81/173 - (46%)
Similarity:112/173 - (64%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRRKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEVETVD-ETFLVSMPNKFRKSMWVKRGDF 72
            ::|||::||:: .||..|||.|:|.:|:.|.|||||||||.: |.||.|||.||||::|:|||||
 Frog     5 TKRKHVVKEVL-GDYVQPTEHQRIVKVLGSPGNNLHEVETSEGERFLASMPTKFRKNIWIKRGDF 68

  Fly    73 LLVEPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKFTK---------------KPVQEEATSQ 122
            |:|:||.||:||||||..||..:|.:...|..:||:.||:               :..:..:|:|
 Frog    69 LIVDPIAEGEKVKAEIAFILYKDHQRLLQKEGLWPEGFTQDKTGVVTKENENNGIQSTEALSTAQ 133

  Fly   123 NK---DDSDFEDD--LLPNTNRPVNRDSSDE-EEDEETSSEED 159
            .|   :||:.:||  |..||||....||.:| |.:||:.||||
 Frog   134 AKEQGEDSETDDDSGLFVNTNRVHYEDSEEESESEEESESEED 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31957NP_001260011.1 S1_like 30..106 CDD:299122 45/76 (59%)
eif1adNP_001016696.1 S1_eIF1AD_like 25..102 CDD:240218 45/76 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..179 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7945
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41860
Inparanoid 1 1.050 139 1.000 Inparanoid score I4397
OMA 1 1.010 - - QHG55346
OrthoDB 1 1.010 - - D1431625at2759
OrthoFinder 1 1.000 - - FOG0004941
OrthoInspector 1 1.000 - - oto104995
Panther 1 1.100 - - LDO PTHR21641
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1961
SonicParanoid 1 1.000 - - X4030
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.