DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31957 and ZK856.11

DIOPT Version :9

Sequence 1:NP_001260011.1 Gene:CG31957 / 319046 FlyBaseID:FBgn0051957 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_505624.1 Gene:ZK856.11 / 179417 WormBaseID:WBGene00014112 Length:175 Species:Caenorhabditis elegans


Alignment Length:154 Identity:59/154 - (38%)
Similarity:90/154 - (58%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRRKHLMKEMMEDDYALPTETQQIARVISSRGNNLHEV-ETVDETFLVSMPNKFRKSMWVKRGDF 72
            ::::::..::..:.|.|..| ..||:|..||||||||| :...::::||||.|||||:|::|..|
 Worm     5 TKKRYITNKVGSEFYELVDE-DIIAQVRQSRGNNLHEVLDQNGDSYVVSMPTKFRKSVWLRRDQF 68

  Fly    73 LLVEPIEEGDKVKAEICKILTPEHIKEYTKAAIWPDKFTKKPVQ--EEATSQNKDDSDFEDDLLP 135
            ::|.||.||||||.||..||..:::....:...||..|.:..::  .||......|...:||:||
 Worm    69 VVVRPITEGDKVKGEIEYILDQDNVLYIRELGKWPTCFEENALKMTREAKRGQTSDKMIDDDMLP 133

  Fly   136 NTNRPVNRDSSDEEEDEETSSEED 159
                |...:..||.|.|||..|:|
 Worm   134 ----PSESEEEDESEGEETYDEDD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31957NP_001260011.1 S1_like 30..106 CDD:299122 37/76 (49%)
ZK856.11NP_505624.1 S1_like 25..102 CDD:299122 37/76 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167493
Domainoid 1 1.000 72 1.000 Domainoid score I6137
eggNOG 1 0.900 - - E1_KOG2925
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41860
Inparanoid 1 1.050 101 1.000 Inparanoid score I3563
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004941
OrthoInspector 1 1.000 - - oto18917
orthoMCL 1 0.900 - - OOG6_104365
Panther 1 1.100 - - LDO PTHR21641
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1961
SonicParanoid 1 1.000 - - X4030
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.