DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31955 and chtf18

DIOPT Version :9

Sequence 1:NP_001285597.1 Gene:CG31955 / 319045 FlyBaseID:FBgn0051955 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001103572.2 Gene:chtf18 / 554366 ZFINID:ZDB-GENE-050522-508 Length:957 Species:Danio rerio


Alignment Length:119 Identity:24/119 - (20%)
Similarity:44/119 - (36%) Gaps:30/119 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YEYLYDDEKHV------SHMPDSKLS------VRNILDSAYASAE---GKIITRKLSRSIPPYPH 64
            :|..:.||..|      ::.|.:|:|      :....:.|..|.:   .|.:..:...||.|   
Zfish    14 FERQFADELEVMAELESNNPPAAKVSEFRNKPITQTFEEALVSGDQPSRKSVNNQNPESISP--- 75

  Fly    65 AVRVKNGIRVYEYSE----PRKQSYKSSLWKEAYNILHQRLDIAEPIAAKEHVR 114
                    .|||..|    |:.:..:..:.|:....:.|..||..|.:.:.:.|
Zfish    76 --------PVYEEEEESLTPKPKKRRQDVAKKLQFGVDQDDDITPPSSPEVYDR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31955NP_001285597.1 None
chtf18NP_001103572.2 AAA 362..505 CDD:99707
AAA 365..497 CDD:214640
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1969
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.