DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31955 and Chtf18

DIOPT Version :9

Sequence 1:NP_001285597.1 Gene:CG31955 / 319045 FlyBaseID:FBgn0051955 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006245998.1 Gene:Chtf18 / 287146 RGDID:1310473 Length:969 Species:Rattus norvegicus


Alignment Length:86 Identity:17/86 - (19%)
Similarity:32/86 - (37%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 KLSRSIPPYPHAVRVKNGIRVYEYSEPRKQSYKSSLWKEAYNILHQRLDIAEPIAAKEHVRTQIH 118
            :|.|.:|..|.|..|     ::..|...:.::.|| .:||...|.|         .:.|::|.:.
  Rat   687 QLLRYLPFLPAAFHV-----LFASSHVPRITFPSS-QQEAQTRLSQ---------TRNHIQTLVS 736

  Fly   119 PCLHKIKGLLDPETCIKCPRC 139
            ......:....|:..:....|
  Rat   737 GMAPATRSRATPQALVLDTLC 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31955NP_001285597.1 None
Chtf18XP_006245998.1 AAA 346..516 CDD:99707
DNA_pol3_delta <486..553 CDD:303078
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1969
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.