DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31955 and Chtf18

DIOPT Version :9

Sequence 1:NP_001285597.1 Gene:CG31955 / 319045 FlyBaseID:FBgn0051955 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006524080.1 Gene:Chtf18 / 214901 MGIID:2384887 Length:970 Species:Mus musculus


Alignment Length:53 Identity:12/53 - (22%)
Similarity:25/53 - (47%) Gaps:10/53 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GKIITRKL---SRSI-PPYPHAVRVKNGIRV------YEYSEPRKQSYKSSLW 90
            |:::.||:   ||.: .|...|...:.|:.|      :.::|....:.:.||:
Mouse   913 GRVVIRKVAVPSREVEAPQKDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLY 965

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31955NP_001285597.1 None
Chtf18XP_006524080.1 PRK04195 343..>589 CDD:235250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1969
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.