powered by:
Protein Alignment CG31955 and Chtf18
DIOPT Version :9
Sequence 1: | NP_001285597.1 |
Gene: | CG31955 / 319045 |
FlyBaseID: | FBgn0051955 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006524080.1 |
Gene: | Chtf18 / 214901 |
MGIID: | 2384887 |
Length: | 970 |
Species: | Mus musculus |
Alignment Length: | 53 |
Identity: | 12/53 - (22%) |
Similarity: | 25/53 - (47%) |
Gaps: | 10/53 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 GKIITRKL---SRSI-PPYPHAVRVKNGIRV------YEYSEPRKQSYKSSLW 90
|:::.||: ||.: .|...|...:.|:.| :.::|....:.:.||:
Mouse 913 GRVVIRKVAVPSREVEAPQKDADEWRMGVAVGRSEVWFRFNEGVSNAVRRSLY 965
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31955 | NP_001285597.1 |
None |
Chtf18 | XP_006524080.1 |
PRK04195 |
343..>589 |
CDD:235250 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1969 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.