DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31955 and ctf-18

DIOPT Version :10

Sequence 1:NP_722935.1 Gene:CG31955 / 319045 FlyBaseID:FBgn0051955 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_501841.1 Gene:ctf-18 / 177879 WormBaseID:WBGene00010676 Length:850 Species:Caenorhabditis elegans


Alignment Length:134 Identity:32/134 - (23%)
Similarity:56/134 - (41%) Gaps:24/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEGDKVVFHS----SDLPYEYLYDDEKHVSHMP--DSK----LSVRNILDS-AYASAEGKI---- 50
            |:.|..|.||    .|...|| .|||..::.:|  ||:    ..|||.|:. .|...:.::    
 Worm     1 MDDDYNVLHSGFADDDGQLEY-PDDEDQLAVVPNGDSENQRINEVRNALEEVGYGKRKRRLNEVE 64

  Fly    51 -ITRKLSRSIPPYPHAVRVKNGIRVYEYSEPRKQSYKSSLWKEAYNILHQRLDIAEPIAAKEHVR 114
             :..:..|...|....:|::.     ..||..::|..:::.:.|...|.|:::  |..|..|...
 Worm    65 DVFDQYGRRSHPMDWHMRMET-----VSSEVLQKSQVNAVKRRALESLEQKIN--EAAAQAERKM 122

  Fly   115 TQIH 118
            .:.|
 Worm   123 NENH 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31955NP_722935.1 None
ctf-18NP_501841.1 PRK04195 265..>684 CDD:235250
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.