powered by:
Protein Alignment Sbat and MAK31
DIOPT Version :9
Sequence 1: | NP_001259971.1 |
Gene: | Sbat / 319043 |
FlyBaseID: | FBgn0051950 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009948.1 |
Gene: | MAK31 / 850383 |
SGDID: | S000000614 |
Length: | 88 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 22/69 - (31%) |
Similarity: | 38/69 - (55%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 KLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEGQEPRLLGNVMVPGQHIVSLS 108
||..::|..|.:.:|:.|:|||.....|...|::|....|.: |...|::|.|.||.:.:.::.
Yeast 5 KLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERM--GSSSRMMGLVSVPRRSVKTIM 67
Fly 109 IDEP 112
||:|
Yeast 68 IDKP 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Sbat | NP_001259971.1 |
LSMD1 |
42..110 |
CDD:212486 |
19/65 (29%) |
MAK31 | NP_009948.1 |
LSMD1 |
3..69 |
CDD:212486 |
19/65 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105331 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.800 |
|
Return to query results.
Submit another query.