DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and MAK31

DIOPT Version :9

Sequence 1:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_009948.1 Gene:MAK31 / 850383 SGDID:S000000614 Length:88 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:22/69 - (31%)
Similarity:38/69 - (55%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEGQEPRLLGNVMVPGQHIVSLS 108
            ||..::|..|.:.:|:.|:|||.....|...|::|....|.:  |...|::|.|.||.:.:.::.
Yeast     5 KLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERM--GSSSRMMGLVSVPRRSVKTIM 67

  Fly   109 IDEP 112
            ||:|
Yeast    68 IDKP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 19/65 (29%)
MAK31NP_009948.1 LSMD1 3..69 CDD:212486 19/65 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105331
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.