DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and smB

DIOPT Version :10

Sequence 1:NP_722859.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_193777.1 Gene:smB / 827792 AraportID:AT4G20440 Length:257 Species:Arabidopsis thaliana


Alignment Length:82 Identity:26/82 - (31%)
Similarity:45/82 - (54%) Gaps:11/82 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYL-----------VEGQEPRLLGNV 97
            |:.:::...:|:.|.|||.|||.|...||..|:||..|.|:.           .|.::.|.||.|
plant     8 KMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKINEEREDRRTLGLV 72

  Fly    98 MVPGQHIVSLSIDEPDP 114
            ::.|:.::|::::.|.|
plant    73 LLRGEEVISMTVEGPPP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_722859.1 LSMD1 42..110 CDD:212486 24/76 (32%)
smBNP_193777.1 Sm_B 5..85 CDD:212464 24/76 (32%)

Return to query results.
Submit another query.