DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and Naa38

DIOPT Version :9

Sequence 1:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_084359.1 Gene:Naa38 / 78304 MGIID:1925554 Length:125 Species:Mus musculus


Alignment Length:83 Identity:37/83 - (44%)
Similarity:51/83 - (61%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QMNDASLTPGRRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYL-----VEGQEP 91
            :..|:..|..|::|:..|.:.:||.:||||.|||.|.|||||.|::|....|:|     ....||
Mouse    32 EQEDSPATRARQQLEALLNKTMRIRMTDGRTLVGCFLCTDRDCNVILGSAQEFLKPSDSFSAGEP 96

  Fly    92 RLLGNVMVPGQHIVSLSI 109
            |:||..||||.||||:.:
Mouse    97 RVLGLAMVPGHHIVSIEV 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 35/73 (48%)
Naa38NP_084359.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 2/9 (22%)
LSMD1 42..115 CDD:212486 35/73 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834662
Domainoid 1 1.000 67 1.000 Domainoid score I9852
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5260
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004610
OrthoInspector 1 1.000 - - oto93262
orthoMCL 1 0.900 - - OOG6_105331
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6149
SonicParanoid 1 1.000 - - X4939
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.