DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and SNRPB

DIOPT Version :10

Sequence 1:NP_722859.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_937859.1 Gene:SNRPB / 6628 HGNCID:11153 Length:240 Species:Homo sapiens


Alignment Length:90 Identity:25/90 - (27%)
Similarity:52/90 - (57%) Gaps:10/90 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LTPGR-RKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEY---------LVEGQEPR 92
            :|.|: .|:.:.:...:|.::.|||:.:|.|...|:..|::|..|.|:         ..|.:|.|
Human     1 MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKR 65

  Fly    93 LLGNVMVPGQHIVSLSIDEPDPQSS 117
            :||.|::.|:::||::::.|.|:.:
Human    66 VLGLVLLRGENLVSMTVEGPPPKDT 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_722859.1 LSMD1 42..110 CDD:212486 21/77 (27%)
SNRPBNP_937859.1 Sm_B 5..83 CDD:212464 21/77 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..240
Repeat-rich region 175..236
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.