DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and natc-3

DIOPT Version :9

Sequence 1:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001379978.1 Gene:natc-3 / 3565103 WormBaseID:WBGene00021682 Length:103 Species:Caenorhabditis elegans


Alignment Length:88 Identity:26/88 - (29%)
Similarity:46/88 - (52%) Gaps:8/88 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DASLTPGRRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEGQEP-----RLL 94
            :|..:....|:.:::|:...|.:||||.:.|....||:|||:|.:...|..  .::|     |.|
 Worm    17 NAKKSEAHLKVLEYIGKRYEIRMTDGRYIRGTMIATDKDANMVFNKADERW--DKDPQLKGVRFL 79

  Fly    95 GNVMVPGQHIVSLSIDEPDPQSS 117
            |..|:..:|:.|:.. .|||:.:
 Worm    80 GQAMISKKHVESMHA-LPDPKET 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 22/72 (31%)
natc-3NP_001379978.1 LSMD1 25..93 CDD:212486 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004610
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.