DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and SmB

DIOPT Version :9

Sequence 1:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster


Alignment Length:87 Identity:29/87 - (33%)
Similarity:50/87 - (57%) Gaps:10/87 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LTPGR-RKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEY---------LVEGQEPR 92
            :|.|: .|:.:.|...:|||:.|.|..:|.|...|:..|::|..|.|:         :.|.:|.|
  Fly     1 MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKR 65

  Fly    93 LLGNVMVPGQHIVSLSIDEPDP 114
            :||.|::.|::||||:::.|.|
  Fly    66 VLGFVLLRGENIVSLTVEGPPP 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 25/77 (32%)
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.