DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sbat and naa38

DIOPT Version :9

Sequence 1:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_001153763.1 Gene:naa38 / 335819 ZFINID:ZDB-GENE-030131-7762 Length:109 Species:Danio rerio


Alignment Length:97 Identity:36/97 - (37%)
Similarity:59/97 - (60%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TTNAPHQMNDASLTPGRRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYL----- 85
            :|...:::.:.:.:..|.||:..|.:.:||.:||||.|||.|.|||||.|::|....|:|     
Zfish     9 STQMQNEVVELAYSLARCKLENLLNKSMRIRMTDGRTLVGLFLCTDRDCNVILGSAQEFLKSTDS 73

  Fly    86 VEGQEPRLLGNVMVPGQHIVSLSIDEPDPQSS 117
            :...|||:||..|:||.|:||:.::....|::
Zfish    74 LSQGEPRVLGLAMIPGHHVVSIEVETESLQTT 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 34/72 (47%)
naa38NP_001153763.1 LSMD1 25..98 CDD:212486 34/72 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577668
Domainoid 1 1.000 69 1.000 Domainoid score I9616
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5274
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549327at2759
OrthoFinder 1 1.000 - - FOG0004610
OrthoInspector 1 1.000 - - oto38890
orthoMCL 1 0.900 - - OOG6_105331
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6149
SonicParanoid 1 1.000 - - X4939
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.