powered by:
Protein Alignment Sbat and naa38
DIOPT Version :9
Sequence 1: | NP_001259971.1 |
Gene: | Sbat / 319043 |
FlyBaseID: | FBgn0051950 |
Length: | 121 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001263428.1 |
Gene: | naa38 / 100038287 |
XenbaseID: | XB-GENE-5856115 |
Length: | 113 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 36/74 - (48%) |
Similarity: | 48/74 - (64%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 RRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEG-----QEPRLLGNVMVPG 101
|.||:..|.|.:||.:||||.|:|.|.|||||.|::|....|:|... :|||:||..||||
Frog 30 RHKLESLLNRNMRIEMTDGRSLIGCFLCTDRDCNVILGSAQEFLRPSDSFPVREPRVLGLAMVPG 94
Fly 102 QHIVSLSID 110
.||||:.::
Frog 95 HHIVSIQVE 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I9501 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
72 |
1.000 |
Inparanoid score |
I5133 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1549327at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004610 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103507 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10701 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R6149 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X4939 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
10 | 10.100 |
|
Return to query results.
Submit another query.