DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and RRP4

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_011936.1 Gene:RRP4 / 856466 SGDID:S000001111 Length:359 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:62/255 - (24%)
Similarity:87/255 - (34%) Gaps:92/255 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 STIVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDN---------- 59
            |.||.|||.:.                    ||        |:..:..||:::||          
Yeast    52 SQIVTPGELVT--------------------DD--------PIWMRGHGTYFLDNMTYSSVAGTV 88

  Fly    60 -----------YQRRYIPARGDLILGIVRAKAGDLYRVDIGATDTA-----------SISYLAFE 102
                       .:.||.|..||.::|.:.......::||||....|           .|.....|
Yeast    89 SRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSE 153

  Fly   103 AASKKNRPDLIPGDLIYARVLNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRE 167
            :...:.|..|..|||:.|.|.:...|....|..     :|.|.|.|.:|.|              
Yeast   154 SDELQMRSFLKEGDLLNAEVQSLFQDGSASLHT-----RSLKYGKLRNGMF-------------- 199

  Fly   168 NCPVLAAL-------TRELPYEIAV--GVNGRIWLKAHS---LKETVALANAISALEQSG 215
             |.|.::|       |..||..|.|  ||||.|||:..|   |......||..|:::.:|
Yeast   200 -CQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANNSSSIKSTG 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 61/251 (24%)
S1_Rrp40 63..148 CDD:240216 25/95 (26%)
RRP4NP_011936.1 Rrp4 45..316 CDD:224022 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.