DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and AT2G25355

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_565592.1 Gene:AT2G25355 / 817074 AraportID:AT2G25355 Length:241 Species:Arabidopsis thaliana


Alignment Length:235 Identity:85/235 - (36%)
Similarity:134/235 - (57%) Gaps:9/235 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SATSTI---VMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRR 63
            |.||.|   |:||:.:..:..:. ::.:.||.|||:.::.:...:||.||:.:|..:||::..:|
plant     8 SPTSLIDQTVVPGDVVLDLSNMT-NQTIKLGSGLRQDNEVISVMRAGKLRYSKPNKYWVESSHKR 71

  Fly    64 YIPARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYARVLNASAD 128
            |:|...|.:||||....|:.|.:||.....|.:..||||.|:::|.|......|:|.||:..:..
plant    72 YVPRPEDHVLGIVVDCKGENYWIDIKGPQLALLPVLAFEGANRRNYPKFEVSTLLYTRVVKTNTG 136

  Fly   129 IEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRE-NCPVLAALTRELPYEIAVGVNGRIW 192
            :.|||.||:..||:...|.|.|||.|:.|..|.||||.. .||||.||.::|.:|.|.|:|||.|
plant   137 MNPELSCVDESGKAAGFGPLKDGFMFETSTGLSRMLLSSPTCPVLEALGKKLSFETAFGLNGRCW 201

  Fly   193 LKAHSLKETVALANAISALEQ-SGCAE---IDKICGNLGD 228
            :.|.:.:..:.:|||:...|. ||..:   ::|:...:.|
plant   202 VHAAAPRIVIIVANALMNSETLSGTQQRIMVEKLLEKISD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 78/211 (37%)
S1_Rrp40 63..148 CDD:240216 32/84 (38%)
AT2G25355NP_565592.1 Rrp4 15..239 CDD:224022 80/224 (36%)
S1_Rrp40 71..156 CDD:240216 32/84 (38%)
KH_6 159..204 CDD:292607 23/44 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2405
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6867
Inparanoid 1 1.050 147 1.000 Inparanoid score I1742
OMA 1 1.010 - - QHG54235
OrthoDB 1 1.010 - - D1284731at2759
OrthoFinder 1 1.000 - - FOG0004390
OrthoInspector 1 1.000 - - otm3054
orthoMCL 1 0.900 - - OOG6_102463
Panther 1 1.100 - - O PTHR21321
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.