DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and exosc2

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001017572.2 Gene:exosc2 / 550234 ZFINID:ZDB-GENE-050417-27 Length:295 Species:Danio rerio


Alignment Length:228 Identity:54/228 - (23%)
Similarity:88/228 - (38%) Gaps:55/228 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
            :|:||:.|.:      ....:.|.|....:|.:.||.||.:..... ...|...:.||....||:
Zfish    28 LVVPGDVITS------DTGFMRGHGTYMDEDRLTASVAGQVERVNK-LICVKPLKTRYNGEVGDV 85

  Fly    72 ILGIVRAKAGDLYRVDIGATDTASISYLAFEAAS-------KKNRPD-------LIPGDLIYARV 122
            ::|.:.......::|:   |::...|.|...|.:       :::..|       |..||||.|.|
Zfish    86 VVGRITEVQQKRWKVE---TNSRLDSVLLLSAVNLPGGELRRRSTQDELAMRDYLQEGDLISAEV 147

  Fly   123 LNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRE-----NCPVLAALTRELPYE 182
            .:..:|     ..::...:|.|.|.|..|.....|.:|   :.|:     |.|..|:|       
Zfish   148 QSIFSD-----GALSLHTRSLKYGKLGQGVLVYVSPSL---VKRQKTHFHNLPCGASL------- 197

  Fly   183 IAVGVNGRIWLKAHSLKETVALANAISALEQSG 215
             .:|.||.:|     |..|.||..     ||:|
Zfish   198 -ILGNNGYVW-----LSPTPALQE-----EQAG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 51/224 (23%)
S1_Rrp40 63..148 CDD:240216 22/98 (22%)
exosc2NP_001017572.2 ECR1_N 28..65 CDD:291080 11/42 (26%)
S1_Rrp4 77..168 CDD:240215 22/98 (22%)
KH_6 171..211 CDD:292607 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.