DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and Rrp4

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001286771.1 Gene:Rrp4 / 37731 FlyBaseID:FBgn0034879 Length:298 Species:Drosophila melanogaster


Alignment Length:244 Identity:58/244 - (23%)
Similarity:89/244 - (36%) Gaps:62/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
            :..||      |.|......:.|.|....|:.:.:|.||.:: |......|...:.||:...||:
  Fly    29 VYTPG------EVLMPEAGFMRGHGTFVEDENIKSSVAGVIQ-KVNKLISVRPLKSRYVGEIGDV 86

  Fly    72 ILGIVRAKAGDLYRVDIGATDTASISYLAFEAAS-------KKNRPD-------LIPGDLIYARV 122
            ::..|.......:|||   |::...|.|...:.:       :::..|       |..||||.|.|
  Fly    87 VVARVSEVQQKRWRVD---TNSRLDSILLLSSVNLPGGELRRRSAEDEQMMRRYLDEGDLISAEV 148

  Fly   123 LNASADIEPELVCVNSVGKSGKLGVLTDGFFFKC--SLNLGRMLLRENCPVLAALTRELPYEIAV 185
            .|...:....|..     :|.|.|.|:.|...|.  :|...|.:...|.|..|:        :.:
  Fly   149 QNIFEEGSLSLYT-----RSLKYGKLSQGILVKVFPALVKRRKMHFHNLPCGAS--------VIL 200

  Fly   186 GVNGRIWLK--------------AHSLKETV---------ALANAISAL 211
            |.||.||:.              |.:|.|.|         .|.|:|.||
  Fly   201 GNNGYIWISPTKGQEEEGGEGGFAQNLNEHVPRADREVIARLRNSILAL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 58/244 (24%)
S1_Rrp40 63..148 CDD:240216 24/98 (24%)
Rrp4NP_001286771.1 Rrp4 27..>209 CDD:224022 49/202 (24%)
KH-I 172..290 CDD:412160 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21321
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.