DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and Exosc2

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001102422.1 Gene:Exosc2 / 366017 RGDID:1306573 Length:293 Species:Rattus norvegicus


Alignment Length:207 Identity:44/207 - (21%)
Similarity:78/207 - (37%) Gaps:47/207 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
            :|:||:.|.......:.....:|      ::.::||.||.:..... ...|...:.||....||:
  Rat    26 LVVPGDTITTDTGFMRGHGTYMG------EEKLIASVAGSVERVNK-LICVKALKTRYNGEVGDI 83

  Fly    72 ILGIVRAKAGDLYRVDIGATDTASISYLAFEAAS-------KKNRPD-------LIPGDLIYARV 122
            ::|.:.......::|:   |::...|.|...:.:       :::..|       |..||||.|.|
  Rat    84 VVGRITEVQQKRWKVE---TNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEV 145

  Fly   123 LNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTR----ELP--Y 181
            ....:|     ..|:...:|.|.|.|..|...:.|            |.|....:    :||  .
  Rat   146 QAVFSD-----GAVSLHTRSLKYGKLGQGALVQVS------------PALVKRQKTHFHDLPCGA 193

  Fly   182 EIAVGVNGRIWL 193
            .:.:|.||.||:
  Rat   194 SVILGNNGFIWI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 44/207 (21%)
S1_Rrp40 63..148 CDD:240216 22/98 (22%)
Exosc2NP_001102422.1 Rrp4 22..243 CDD:224022 44/207 (21%)
KH-I_Rrp4_eukar 169..285 CDD:411953 11/49 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.