DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and wu:fc33b09

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001373170.1 Gene:wu:fc33b09 / 324574 ZFINID:ZDB-GENE-030131-3295 Length:247 Species:Danio rerio


Alignment Length:219 Identity:93/219 - (42%)
Similarity:148/219 - (67%) Gaps:7/219 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERI------AAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYI 65
            :|:||:.:      .|.:...|:.|:|.||||||....:...:||.|:||:|..:||:..||||:
Zfish    16 VVLPGDLLFSFSPPEAGDANPKADRLICGPGLRRSGAEIRVCRAGVLKHKQPNMYWVNCQQRRYV 80

  Fly    66 PARGDLILGIVRAKAGDLYRVDIGATDTASISYLAFEAASKKNRPDLIPGDLIYARVLNASADIE 130
            ||:|:.::|||.||:||:::||:|.::.||:||||||.|:|:|||::..|||::.:...|:.|:|
Zfish    81 PAKGESVIGIVTAKSGDVFKVDVGGSEQASLSYLAFEGATKRNRPNVQVGDLVFGQFTIANKDME 145

  Fly   131 PELVCVNSVGKSGKLGVL-TDGFFFKCSLNLGRMLLRENCPVLAALTRELPYEIAVGVNGRIWLK 194
            |||||::|.|::..:||. .||..||.||.|.|.||.....:::.|.:..|.|:.||:|||:|:|
Zfish   146 PELVCIDSCGRANGMGVFGGDGLLFKVSLGLVRRLLAPQSDLVSDLEKMFPCEMVVGMNGRVWVK 210

  Fly   195 AHSLKETVALANAISALEQSGCAE 218
            |.:::.|:.|:|.:.|.|....|:
Zfish   211 ARTVQHTLILSNLLEACENMSTAQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 91/212 (43%)
S1_Rrp40 63..148 CDD:240216 42/84 (50%)
wu:fc33b09NP_001373170.1 S1_Rrp40 78..163 CDD:240216 42/84 (50%)
KH-I_Rrp40 166..243 CDD:411954 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1284731at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.