DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rrp40 and EXOSC2

DIOPT Version :9

Sequence 1:NP_001285565.1 Gene:Rrp40 / 319033 FlyBaseID:FBgn0260648 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_055100.2 Gene:EXOSC2 / 23404 HGNCID:17097 Length:293 Species:Homo sapiens


Alignment Length:203 Identity:45/203 - (22%)
Similarity:81/203 - (39%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
            :|:||:.|.......:.....:|      ::.::||.||.:..... ...|...:.|||...||:
Human    26 LVVPGDTITTDTGFMRGHGTYMG------EEKLIASVAGSVERVNK-LICVKALKTRYIGEVGDI 83

  Fly    72 ILGIVRAKAGDLYRVDIGATDTASISYLAFEAAS-------KKNRPD-------LIPGDLIYARV 122
            ::|.:.......::|:   |::...|.|...:.:       :::..|       |..||||.|.|
Human    84 VVGRITEVQQKRWKVE---TNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEV 145

  Fly   123 LNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELP--YEIAV 185
            ....:|     ..|:...:|.|.|.|..|...:.|.:|   :.|:....     .:||  ..:.:
Human   146 QAVFSD-----GAVSLHTRSLKYGKLGQGVLVQVSPSL---VKRQKTHF-----HDLPCGASVIL 197

  Fly   186 GVNGRIWL 193
            |.||.||:
Human   198 GNNGFIWI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rrp40NP_001285565.1 Rrp4 5..213 CDD:224022 45/203 (22%)
S1_Rrp40 63..148 CDD:240216 23/98 (23%)
EXOSC2NP_055100.2 Rrp4 22..241 CDD:224022 45/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1097
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.