Sequence 1: | NP_001285565.1 | Gene: | Rrp40 / 319033 | FlyBaseID: | FBgn0260648 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055100.2 | Gene: | EXOSC2 / 23404 | HGNCID: | 17097 | Length: | 293 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 81/203 - (39%) | Gaps: | 39/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 IVMPGERIAAIEELAKSKRVILGPGLRRLDDTVVASKAGPLRHKEPGTFWVDNYQRRYIPARGDL 71
Fly 72 ILGIVRAKAGDLYRVDIGATDTASISYLAFEAAS-------KKNRPD-------LIPGDLIYARV 122
Fly 123 LNASADIEPELVCVNSVGKSGKLGVLTDGFFFKCSLNLGRMLLRENCPVLAALTRELP--YEIAV 185
Fly 186 GVNGRIWL 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rrp40 | NP_001285565.1 | Rrp4 | 5..213 | CDD:224022 | 45/203 (22%) |
S1_Rrp40 | 63..148 | CDD:240216 | 23/98 (23%) | ||
EXOSC2 | NP_055100.2 | Rrp4 | 22..241 | CDD:224022 | 45/203 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1097 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |